SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q4TIX0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4TIX0
Domain Number 1 Region: 2-132
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 2.35e-49
Family ATP-dependent DNA ligase DNA-binding domain 0.00000433
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q4TIX0
Sequence length 133
Comment (tr|Q4TIX0|Q4TIX0_TETNG) Chromosome undetermined SCAF1538, whole genome shotgun sequence {ECO:0000313|EMBL:CAF87162.1} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN=GSTENG00036676001 OC=Tetraodon.
Sequence
RVPYLAVARTFQKIEEDSGRLRNIETLSNLFRSVLLLSPDDLLCCVYLCLNQLGPAYQGA
ELGVGETVLMKAVAQATGRQLDKIKAEAQERGDLGLVAESSRSNQRTMFQPASLTAAGVF
RKFKEIASMSGNA
Download sequence
Identical sequences Q4TIX0
ENSTNIP00000022726 ENSTNIP00000022726 99883.ENSTNIP00000022726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]