SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q4TTC6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4TTC6
Domain Number 1 Region: 56-283
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.76e-39
Family Nuclear receptor ligand-binding domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q4TTC6
Sequence length 293
Comment (tr|Q4TTC6|Q4TTC6_CAEEL) Uncharacterized protein {ECO:0000313|EMBL:CCD61631.1} KW=Complete proteome; Reference proteome OX=6239 OS=Caenorhabditis elegans. GN=CELE_ZK418.10 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MQHRKHCISSDQDAKTYIAHPNCRFCSFKRMVLSQDVNLQFTTIKIASMDLAGLINNLSS
LNINRNEYFMDYYAKEKSSVDNAVISTINFIKKPPYLVFSMEEWTSINQLSTIDFIKKFD
FVNQFSCYSDKSKFIHGVRFKSAIFSTSMRVFNEKKSYMHFPGNVDIFPEHSSQLFNPHF
LNKIRSQLIGKLIELDITKNESLLLSALFLCSAVHPDISTEGKNLLYKYQQYYSAALINH
CCLTNQQNAPSRYSELLSLYQIIEETHQKVNNFAILYRMKMPHKIGIGINKFE
Download sequence
Identical sequences Q4TTC6
NP_001022996.1.50509 ZK418.10 ZK418.10 ZK418.10 6239.ZK418.10

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]