SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q4TU03 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4TU03
Domain Number 1 Region: 206-445
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.54e-70
Family Nuclear receptor ligand-binding domain 0.000000000625
Further Details:      
 
Domain Number 2 Region: 95-181
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-28
Family Nuclear receptor 0.0000957
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q4TU03
Sequence length 447
Comment (tr|Q4TU03|Q4TU03_PIG) Nuclear orphan receptor LXR-alpha {ECO:0000313|EMBL:AAY43056.1} KW=Complete proteome; Reference proteome OX=9823 OS=Sus scrofa (Pig). GN=LXRA OC=Sus.
Sequence
MSLWVEAPVPDVSPDSAVELWESDAQDASSQSLGSSSCILREESSTPQSAGGASRVGLDA
TESTALLPGVEASPESTELRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKG
FFRRSVIKGARYVCHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLK
RQEEEQAQATSVPPRASSPPQVLPQLSPEQLGMIEKLVAAQQQCNRRSFSDQLRVTPWPM
APDPQSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLL
ETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLI
AISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSV
HSEQVFALRLQDKKLPPLLSEIWDVHE
Download sequence
Identical sequences Q4TU03
ENSSSCP00000014069 ENSSSCP00000014069 9823.ENSSSCP00000014069 NP_001095284.1.46622 XP_005660976.1.46622 XP_013849793.1.46622 XP_013849794.1.46622 XP_013849796.1.46622 XP_020937105.1.46622 XP_020937115.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]