SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q4V3M8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4V3M8
Domain Number 1 Region: 77-149
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000654
Family Insect pheromone/odorant-binding proteins 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q4V3M8
Sequence length 218
Comment (tr|Q4V3M8|Q4V3M8_DROME) IP02234p {ECO:0000313|EMBL:AAY55744.1} OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=Obp50c OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MCFCCARLISGSSRNWSYKVSRRCQTKLRLTKKMARHIALLICSLLAMAGCDPIDVDCTR
RQDFNIVKDCCVYPTFRFDQFKSQCGKYMPVGAPRISPCLYECIFNKTNTVVDGAIHPDN
ARLMLEKLFGNQDFEEAYFNGLMGCSDSVQEMISNRRSRPQRKTEQCSPFSLFYGICAQR
YVFNHCPSSSWSGTESCEMARLQNMNCSKPSRGSSHRL
Download sequence
Identical sequences Q4V3M8
7227.FBpp0086681 FBpp0292336 FBpp0292336 FBpp0292336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]