SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q4V785 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4V785
Domain Number 1 Region: 340-593
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.24e-73
Family Eukaryotic proteases 0.00053
Further Details:      
 
Domain Number 2 Region: 108-219
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-16
Family Scavenger receptor cysteine-rich (SRCR) domain 0.013
Further Details:      
 
Domain Number 3 Region: 218-256
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 4 Region: 262-293
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000746
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q4V785
Sequence length 602
Comment (tr|Q4V785|Q4V785_XENTR) Uncharacterized protein {ECO:0000313|EMBL:AAH98090.1} OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=mgc107998 OC=Silurana.
Sequence
MKKLCCIFILLCFFYINTLTSSFSGAEDVRPNKCEFTSLSCHKVFCAPWQRCVAGVCRCK
LPYQCPRNATTEVCTEGKRKLQTYCQQKSVECSNPSNVKYRFSSEAPCTDTFSVRLTGSK
ETSKGIIKVKLPTLEKELFICAKQWSLREANVVCKQLGFPRGADAPASNKDLPLVTKESP
EEHCLQATCRGLENSLAECALRKLPVEKQVAEVKCYTENRDCGSGEFKCSNGKCIPSELA
CDSENDCGDLSDELCCKDCSAGFHCKSDTCIPERYKCNGELDCISEEDESNCEVEQEPKS
EKQEEEGQESKAIQNEETGNIVNYDMDAERRLVMKSLPELSCGVPPPAAPTKITRKKRVI
GGTNAVKNQFPWQVAIKDGTSVNCGGIYIGGCWVLTAAHCVRANQPQRYLIILELLDRLS
YDKDIDSFPVKSVIVHESYNPNTYENDIALLEVKNIYSNPKCMQTDNNMVPACVPWSPFQ
FRAGDTCTVSGWGREKGMSRVFHLKWGHINLMNNCSEVYKERFLDKMECAGTYDGSIDAC
KGDSGGPLVCYDVNNVAYVWGIVSWGENCGVPGFPGVYTKVAHYYEWISHQVGRSLISKY
NV
Download sequence
Identical sequences Q4V785
NP_001027508.1.99540 gi|66990056|gb|AAH98090| gi|73853846|ref|NP_001027508|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]