SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q4VAH9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4VAH9
Domain Number 1 Region: 14-48
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000759
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q4VAH9
Sequence length 306
Comment (tr|Q4VAH9|Q4VAH9_MOUSE) DNA segment, Chr 18, ERATO Doi 653, expressed, isoform CRA_a {ECO:0000313|EMBL:EDL09616.1} OX=10090 OS=Mus musculus (Mouse). GN=mCG_141221 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MPEAGFQATNAFTECKFTCTSGKCLYLGSLVCNQQNDCGDNSDEENCLLVTEHPPPGIFN
SELEFAQILIIVVVVTVMVVVVVCLLNHYKVSTRSFINRPNQSQRQEDGLQPEGSLWPSD
SSVQRPGASEIMCAPRGRDRFTTPSFIQRDPFSRFQPTYPYVQHEIDLPPTISLSDGEEP
PPYQGPCTLQLRDPEQQMELNRESVRAPPNRTVFDSDLIDISMYNGGPCPPSSHSGISAA
TCSSNGRMEGPPPTYSEVMGHYPGTSFFHHQHSNTHRGSRPQFQPNNSEGTIVPIKGKDR
KPGDLV
Download sequence
Identical sequences Q4VAH9 Q8BWJ4
ENSMUSP00000068471 ENSMUSP00000068471 ENSMUSP00000068471 10090.ENSMUSP00000068471 NP_766219.2.92730 XP_006526148.1.92730 XP_006526149.1.92730 XP_006526150.1.92730 XP_006526151.1.92730 XP_006526152.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]