SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q4VIT5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4VIT5
Domain Number 1 Region: 20-217
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.38e-62
Family Calnexin/calreticulin 0.0000523
Further Details:      
 
Domain Number 2 Region: 201-315
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 6.67e-46
Family P-domain of calnexin/calreticulin 0.000000604
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q4VIT5
Sequence length 417
Comment (sp|Q4VIT5|CALR_CHLAE) Calreticulin OX=9534 OS=Chlorocebus aethiops (Green monkey) (Cercopithecus aethiops). GN=CALR; OC=Catarrhini; Cercopithecidae; Cercopithecinae; Chlorocebus.
Sequence
MLLSVPLLLGLLGLAAAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDE
EKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQT
DMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDN
TYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPE
HIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYS
PDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDK
QDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL
Download sequence
Identical sequences A0A2K6ACZ5 A0A2K6CEN9 G7NLC3 Q2HWU3 Q4R6K8 Q4VIT5
NP_001248060.1.72884 NP_001274539.1.63531 XP_011711611.1.29376 XP_011850283.1.47321 ENSMMUP00000005869 9544.ENSMMUP00000005869 ENSMMUP00000005869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]