SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q4WF29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4WF29
Domain Number 1 Region: 6-284
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.92e-50
Family IroE-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q4WF29
Sequence length 292
Comment (tr|Q4WF29|Q4WF29_ASPFU) Siderophore esterase IroE-like, putative {ECO:0000313|EMBL:EAL86648.1} KW=Complete proteome; Reference proteome OX=330879 OS=A1100) (Aspergillus fumigatus). GN=AFUA_3G03660 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MGDRPTPVPLPNSEQFYLENDRGEPYLIQVSWPLHWEDKQTGRGPLPIIYIVDGNALFLT
ATEAAWRRAAASHFAGGGIIVAIGYPLKGKLYDARRRSFDLTPPTACAPVGYGGADVFLD
FIENSVRPAVQARFPQVSLAREALYGHSYGGLLALHALFTRPQSFDCYIASSPSIWWNSL
CILHEAKAFVETKKVSHDQSPSLMVSWGSWEQHPPRWADELLDHYEARKRTAAELRMADN
ALDLCAMLHGCSRLHALIKTEYEGEDHTSVMSCSVSRGLTMFFEDWPFHQSG
Download sequence
Identical sequences B0XZL7 Q4WF29
Afu3g03660 XP_748686.1.65241 Afum_A1163:AFUB_044480.t1 5085.CADAFUAP00000120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]