SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q4X6G1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4X6G1
Domain Number 1 Region: 216-255
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000201
Family Merozoite surface protein 1 (MSP-1) 0.024
Further Details:      
 
Domain Number 2 Region: 169-202
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000614
Family EGF-type module 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q4X6G1
Sequence length 277
Comment (tr|Q4X6G1|Q4X6G1_PLACH) Uncharacterized protein {ECO:0000313|EMBL:CAH87515.1} KW=Complete proteome; Reference proteome OX=5825 OS=Plasmodium chabaudi. GN=PC302507.00.0 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
DVKTVFKRCFNRDDPELSKSYEKIEDQAAKDHTTVGEVLSNYIAAVFTKMNDEFIKNDGF
KLSKYIPELEIINYAIMNGPKEMGDKIINSVNELNKLVVSESLTSIYESVVSGLNINCKI
KDDIITILNLADGKYFKIDLSGEARMIVPGQYSHEQVHMKKIPEYFIAKNRVCKTEKCPI
NSNCYVIENVETCRCIPGFSNNEETEGFKCDVDKSASCEKNNGGCDENATCLVLEDKIMC
ECNDKFNGDGIYCSNAIFYGMNTFIFFLISIVCVYIM
Download sequence
Identical sequences Q4X6G1
gi|56514664|emb|CAH87515.1| gi|70934426|ref|XP_738441.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]