SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q4Y2N4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4Y2N4
Domain Number 1 Region: 115-153
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000119
Family Merozoite surface protein 1 (MSP-1) 0.057
Further Details:      
 
Domain Number 2 Region: 66-100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000244
Family Merozoite surface protein 1 (MSP-1) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q4Y2N4
Sequence length 177
Comment (tr|Q4Y2N4|Q4Y2N4_PLACH) Plasmodium falciparum MSP8-like protein, putative {ECO:0000313|EMBL:CAH76576.1} KW=Complete proteome; Reference proteome OX=5825 OS=Plasmodium chabaudi. GN=PC000566.01.0 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
NAEKKSENGKDAMDHAQIMHITMLEENRNLKETTRILDETVYTFERFILKCKFYITAIIN
FVKFKTNHICEYSKCGDHARCYIVENDQQECRCLANYVRDTSVEYFKCIPMTTKDCTNNN
GNCDKNAECSIKNNNIICYCSYNFFGDGIFCVPNSNYNNFLHISLIIIGCILQKFLF
Download sequence
Identical sequences Q4Y2N4
gi|56510675|emb|CAH76576.1| gi|70928002|ref|XP_736276.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]