SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q4YQA0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4YQA0
Domain Number 1 Region: 154-199
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000286
Family Tudor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q4YQA0
Sequence length 259
Comment (tr|Q4YQA0|Q4YQA0_PLABA) Uncharacterized protein {ECO:0000313|EMBL:CAH99809.1} KW=Complete proteome; Reference proteome OX=5823 OS=Plasmodium berghei (strain Anka). GN=PB000532.03.0 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
EKINEYNKQLALVRDEIKKYEQIQNDQNEENEQIQNLKKLECDMIEVINLTRDLIKYKKK
NESDDEIPNQIAEENEQPFSNENVMNESELLIGRTCSFMYENKIVYGSIENVVIQNNMEQ
LLVHIFETNEQVLVQKNYVQLNEILHTLSASENNQFQALYKKDGQWYDCMVSKSKGDSYL
ITYIGYNNSEYVKNDQIRIKKKKKIKEVITPAGYKIPENLIIKENDSLKTKLKKTKKRNA
LKKKQKNELINKEFANKAQ
Download sequence
Identical sequences Q4YQA0
gi|68067424|ref|XP_675680.1| XP_675680.1.11252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]