SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q4YRN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4YRN8
Domain Number 1 Region: 348-387
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000209
Family Merozoite surface protein 1 (MSP-1) 0.023
Further Details:      
 
Domain Number 2 Region: 301-334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000392
Family EGF-type module 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q4YRN8
Sequence length 409
Comment (tr|Q4YRN8|Q4YRN8_PLABA) Merozoite surface protein 8, putative {ECO:0000313|EMBL:CAH99319.1} KW=Complete proteome; Reference proteome OX=5823 OS=Plasmodium berghei (strain Anka). GN=PB000173.03.0 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
MKRSSQIIIFLLLSLVCKFSIGICKENGNGNINKSNNNRVIKKERKRKAKSNANKNEPEN
KEHEIINLYDDVQELLGNERMSMLDKYSILGIDDCSNESENNKIIGEYDLKAMKSVLLYK
NRISKVSLENLYDVKTVFKRCFNKDDPELSKSYEHLQDQAAIEGTTIIDYLSNYILNVYV
KMNDEFIKNDGFKLSKYIPELEIINYALYNGPKELENRIKSGLNEINNIIISESLTSIYS
SVVSGLNINCKIKDDLITILNLSDGKYFKVDFSSQATMIVPGQYSHEHGNMKKISEYFIE
KNRICKNEKCPINSNCYVIDNVETCRCIPGFSKNKESESLKCDIDESTSCENNNGGCDVN
ATCLLLEDKIMCECNNKYNGDGIYCSNAIYYGMNVFVFFLISIVCIYIM
Download sequence
Identical sequences A0A077XDA8 A0A0Y9XJ90 Q4YRN8
XP_676553.1.11252 gi|68069285|ref|XP_676553.1| PBANKA_110220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]