SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q4ZG53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4ZG53
Domain Number 1 Region: 3-36
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000327
Family LDL receptor-like module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q4ZG53
Sequence length 40
Comment (tr|Q4ZG53|Q4ZG53_HUMAN) Uncharacterized protein LRP1B {ECO:0000313|EMBL:AAX88846.1} OX=9606 OS=Homo sapiens (Human). GN=LRP1B OC=Catarrhini; Hominidae; Homo.
Sequence
QQLCDPGEFLCHDHVTCVSQSWLCDGDPDCPDDSDESLDT
Download sequence
Identical sequences F7CU16 Q4ZG53
ENSECAP00000003963 9796.ENSECAP00000003963 ENSECAP00000003963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]