SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q501R2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q501R2
Domain Number 1 Region: 60-569
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 3.18e-194
Family Myeloperoxidase-like 0.000000000000075
Further Details:      
 
Domain Number 2 Region: 20-56
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000629
Family EGF-type module 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q501R2
Sequence length 604
Comment (tr|Q501R2|Q501R2_XENTR) Prostaglandin-endoperoxide synthase 2 (Prostaglandin G/H synthase and cyclooxygenase) {ECO:0000313|EMBL:AAH95912.1} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=TGas066j02.1-001 OC=Silurana.
Sequence
MIVLPAAVFLSLLVFSQAANPCCSNPCQNRGVCMTVGHDRYECDCTRTGFYGENCTKPEF
LSWLRLKLKPAPNTVHYILTHFKGLWNIVNNISFLRDAIMRYVLTSRSHLIDSPPTYNSH
YGYKSWEAFSNLSYYTRTLPPVERDCPTPMGVKGMKELPSAKLVVEKFLMRRKFIPDPQG
SNVMFAFFAQHFTHQFFRTDMAKGAAFTKALGHGVDLNHIYGESLERQHKLRLMKGGKLK
YQMISGEMYPPTVKTTGVDMVYPPHIPDHLQFAVGQEVFGLVPGLMMYSTIWLREHNRVC
DILSNEHPEWDDERIFQTARLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQKFQY
QNRISAEFNTLYHWHPLLPDTFAISEKEYSYPQFLYNNSVMLNHGLTEMVESFSRQTAGR
VAGGRNFPAAITRVAVASIEHSREMRYQSLNEYRKRFMLKPFESFEELTGEKEMSAELEK
LYGDIDAMEFYPGLLVEQPRPGAIFGETMVEIGAPFSLKGLMGNPICSPEYWKPSTFGGS
VGFDIVNSASLQKLICNNVRDCPYTAFHVLKSKPSEKDFINASSDSTLENVKPSLILKEH
ASEL
Download sequence
Identical sequences Q501R2
gi|63100230|gb|AAH95912| gi|71895727|ref|NP_001025697| gi|89269018|gb|CAJ83938| ENSXETP00000037831 8364.ENSXETP00000037831 ENSXETP00000037831 NP_001025697.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]