SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q503Y8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q503Y8
Domain Number - Region: 4-36
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0331
Family PHD domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q503Y8
Sequence length 277
Comment (sp|Q503Y8|EURL_DANRE) Protein EURL homolog {ECO:0000305} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=eurl OC=Cyprinidae; Danio.
Sequence
MEEEEHFVNIDLNDDNICSICKLETDTGTLSFCHVCFELSIEGISSATLLHSKSLRGHRD
CFEKYHLIANQKLSRAKASHSTYEGVKRALSQRINRIIQYAQNRDSVTPENPGRWGAKQI
LCHTQQAGRKLVPQSDAQVPRYAPRWTEEASMVSESDYGKSMLDCHSAEELGLGLWPGER
PQNREQRDSRQRRHSGHSREELMRKNVEELRQLNEQLLLQIQNVFEELSVVVQEKDSLSS
ELHVRHIAIEQLFKNCAKLPWLQIGRAGVKAANNPVE
Download sequence
Identical sequences B2GSJ3 Q503Y8
ENSDARP00000049632 ENSDARP00000109773 7955.ENSDARP00000049632 ENSDARP00000049632 NP_001018388.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]