SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q50LG7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q50LG7
Domain Number 1 Region: 317-575
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.09e-81
Family Eukaryotic proteases 0.000000244
Further Details:      
 
Domain Number 2 Region: 102-207
Classification Level Classification E-value
Superfamily Kringle-like 2.05e-33
Family Kringle modules 0.0002
Further Details:      
 
Domain Number 3 Region: 209-303
Classification Level Classification E-value
Superfamily Kringle-like 2.69e-29
Family Kringle modules 0.00022
Further Details:      
 
Domain Number 4 Region: 34-79
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000345
Family Fibronectin type I module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q50LG7
Sequence length 580
Comment (tr|Q50LG7|Q50LG7_ORYLA) Plasminogen activator {ECO:0000256|PIRNR:PIRNR001145} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=plat OC=Oryziinae; Oryzias.
Sequence
MTRSVHLFFLLSVLCCSLADNAEQPRSKRGARFYRVLCVDSETSAVHGYGDTWLRWKGQR
VEYCHCALRGQERCHSVPVINCYASQCYNGGTCKESVYTSDYICQCPQGFKGAQCEINSN
EKCIVGKGEGYRGTLSVTHSGEECINWNSTSLRGKKFTARKTDASGLGLGNHNFCRNPDQ
DSAPWCYIYKGTQVIWELCSLPKCSGDRNRECVQGLGKSYRGTAAVTKSGSACLPWDAPA
VRRKRNNAWKSNALDLGLSNHNFCRNPDGDSGPWCHTYKKMQLTWELCDIPKCSRAPSTI
TTLGPRAPTTNNNQATCGQRLDNTLSRPAFRIFGGRGSDITEQPWQAAINFYVPRHKRHF
HLCGGVLIDSCWVLSAAHCFQEKDKPEILQVILGRTFRTQNSNSEQIFKVEKLWIHEKFD
SETYDNDIAILKLKTDIGLCAVNSEEVLPACLPDRGLELPDWTECEISGYGKSSEFSPEF
SERVKRGHVRLWPKERCTPDVLSERTVTSNMLCAGDTRGKDDACKGDSGGPLVCRNQNRM
TLMGLVSWGDGCGEKDKPGVYTRVSNYIDWINRKIRVNPV
Download sequence
Identical sequences Q50LG7
ENSORLP00000002926 NP_001098301.1.28442 ENSORLP00000002926 8090.ENSORLP00000002926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]