SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q53LT0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q53LT0
Domain Number 1 Region: 319-457
Classification Level Classification E-value
Superfamily ApaG-like 6.54e-28
Family ApaG-like 0.00034
Further Details:      
 
Domain Number 2 Region: 109-242
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000157
Family SMI1/KNR4-like 0.012
Further Details:      
 
Weak hits

Sequence:  Q53LT0
Domain Number - Region: 36-74
Classification Level Classification E-value
Superfamily F-box domain 0.000148
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q53LT0
Sequence length 457
Comment (tr|Q53LT0|Q53LT0_ORYSJ) Os11g0265200 protein {ECO:0000313|EMBL:BAT13527.1} KW=Complete proteome; Reference proteome OX=39947 OS=Oryza sativa subsp. japonica (Rice). GN=OSNPB_110265200 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MAAPPQPQPEPEPAAGGAGLEALEGLALDTVIAKAGARQAAALACASTRLRDAAGDDALW
RRFCADDLALHAPLAPDGRALPSFKDAYKVWLESFGMYPLPLVRRVKIFWSSLKSWLSEN
FPEAHKTLNKGVSEAQIQSAEDDLGFKLPLPTKLLYRFCNGQLPLSEHHHENMRMAHLGI
IGGYVFYDHLINVHLSPLEQIVEETKEFYREFYDQGVFNMTNLIIVATSWYRPKTFFLNC
SDDQLYVGTINLQDGEMLPCVPKSLIRPTNTDMPQDGLLLWLEEHLRRLQNGMIKIRMLK
TSRYISLFPEASPSCTSAMTNGVKVRASAVFAPEHPESRRPGAKCLYAYSIRLSVPEACM
LGGVYYSSCQLYSRHWIIRWRDRVVSDVNGEGVIGKYPLLTTGQEEFVYESCTPLPDSPG
SVEGSFTFVPGKLSRPEGKPFEVTVAAFPLEIPEYIF
Download sequence
Identical sequences Q53LT0
XP_015615131.1.37577 LOC_Os11g16390.1|PACid:21948596 LOC_Os11g16390.1|13111.m01651|protein 39947.LOC_Os11g16390.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]