SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q543L9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q543L9
Domain Number 1 Region: 174-245
Classification Level Classification E-value
Superfamily Homeodomain-like 1.54e-23
Family Homeodomain 0.00056
Further Details:      
 
Weak hits

Sequence:  Q543L9
Domain Number - Region: 243-284
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.017
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q543L9
Sequence length 311
Comment (tr|Q543L9|Q543L9_MOUSE) Caudal type homeobox 2 {ECO:0000313|EMBL:EDL05830.1} OX=10090 OS=Mus musculus (Mouse). GN=mCG_12742 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAATANLDSAQS
PGPSWPTAYGAPLREDWNGYAPGGAAAANAVAHGLNGGSPAAAMGYSSPAEYHAHHHPHH
HPHHPAASPSCASGLLQTLNLGPPGPAATAAAEQLSPSGQRRNLCEWMRKPAQQSLGSQV
KTRTKDKYRVVYTDHQRLELEKEFHFSRYITIRRKSELAATLGLSERQVKIWFQNRRAKE
RKIKKKQQQQQQQQQQQPPQPPPQPSQPQPGALRSVPEPLSPVTSLQGSVPGSVPGVLGP
AGGVLNSTVTQ
Download sequence
Identical sequences P43241 Q543L9
ENSMUSP00000031650 ENSMUSP00000031650 10090.ENSMUSP00000031650 ENSMUSP00000031650 NP_031699.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]