SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q544K9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q544K9
Domain Number 1 Region: 236-477
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.38e-56
Family Decarboxylase 0.00000054
Further Details:      
 
Domain Number 2 Region: 10-205
Classification Level Classification E-value
Superfamily PRTase-like 2.96e-43
Family Phosphoribosyltransferases (PRTases) 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q544K9
Sequence length 481
Comment (tr|Q544K9|Q544K9_MOUSE) Uridine monophosphate synthetase, isoform CRA_a {ECO:0000313|EMBL:EDK97857.1} OX=10090 OS=Mus musculus (Mouse). GN=mCG_127134 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MEVASQALGPLVTELYDVQAFKFGSFVLKSGLSSPVYIDLRGIVSRPRLLSQVADILFQT
AKNAGISFDSVCGVPYTALPLATVICSANHIPMLIRRKETKDYGTKRLVEGEINPGQTCL
VIEDVVTSGASVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAQGIRLHAVCTLSQML
EILQQQEKIDADMVGRVKRFIQENVFSAANHNGLPPPEKKACKELSFGARAELPGTHPLA
SKLLRLMQKKETNLCLSADVSEARELLQLADALGPSICMLKTHVDILNDFTLDVMEELTA
LAKRHEFLIFEDRKFADIGNTVKKQYESGTFKIASWADIVNAHVVPGSGVVKGLQEVGLP
LHRACLLIAEMSSAGSLATGNYTKAAVGMAEEHCEFVIGFISGSRVSMKPEFLHLTPGVQ
LETGGDHLGQQYNSPQEVIGKRGSDVIIVGRGILAAANRLEAAEMYRKAAWEAYLSRLAV
Q
Download sequence
Identical sequences P13439 Q544K9
399847 ENSMUSP00000023510 ENSMUSP00000023510 NP_033497.1.92730 10090.ENSMUSP00000023510 ENSMUSP00000023510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]