SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q55484 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q55484
Domain Number 1 Region: 56-330
Classification Level Classification E-value
Superfamily PLP-binding barrel 4.06e-72
Family Alanine racemase-like, N-terminal domain 0.00001
Further Details:      
 
Domain Number 2 Region: 304-464
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 5.44e-52
Family Eukaryotic ODC-like 0.0000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q55484
Sequence length 469
Comment (sp|Q55484|DCDA_SYNY3) Diaminopimelate decarboxylase {ECO:0000255|HAMAP-Rule:MF_02120} KW=Complete proteome; Reference proteome OX=1111708 OS=Synechocystis sp. (strain PCC 6803 / Kazusa). GN=sll0504; OC=Synechocystis.
Sequence
MLSTEMPLPTTGSTLLKTPASPSPNQNLLPLTAVINKNGELEIGGCSVPALVEQFGSPLY
ILDETTLRQAAQQYRQSFQAHYPGSSQVIYASKAWSCLAVVAIAAQEGLGFDVVSGGELF
TTVSALKQLGWDEAEIAEKIYFHGNNKSVQELQEAIAINCTIIVDNWLELETLTKLAADS
GAPVKIMLRLTPGIECHTHEYIKTGHLDSKFGFDPNQLEAVFTYIAQQPSLHCLGLHAHI
GSQIFERQPHKDLGEVLVQWFTKGLTYGLPLTELNIGGGLGICYTESDDPPSIEEWAQVA
AISVAKACDRQNIPYPKLIAEPGRSLVGSACVTAYRVGGRKVVPNIRTYISVDGGMSDNP
RPITYQSVYRVALANRMNDEITETVTVAGKHCESGDILVKDVALPAAEPGDIMVVAATGA
YNHSMASNYNRLGRPAAVLVNQGQANLILQRETYTDLLRQDCLPNRLLS
Download sequence
Identical sequences L8AQA3 Q55484
gi|383492828|ref|YP_005410505.1| 1148.sll0504 gi|383326944|ref|YP_005387798.1| gi|383323775|ref|YP_005384629.1| gi|16332032|ref|NP_442760.1| WP_010874055.1.11876 WP_010874055.1.1889 WP_010874055.1.18904 WP_010874055.1.33690 WP_010874055.1.35395 WP_010874055.1.47586 WP_010874055.1.99424 gi|16332032|ref|NP_442760.1| NYSGRC-FDAO-BAA10831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]