SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q55770 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q55770
Domain Number 1 Region: 8-46
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000628
Family Rho termination factor, N-terminal domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q55770
Sequence length 419
Comment (tr|Q55770|Q55770_SYNY3) Sll0185 protein {ECO:0000313|EMBL:BAA10417.1} KW=Complete proteome; Reference proteome OX=1111708 OS=Synechocystis sp. (strain PCC 6803 / Kazusa). GN=sll0185 OC=Synechocystis.
Sequence
MAKEDRPSLKDMTLRQLRRVASECNISRYSRMRKSQLLAEVEKALNKPAPAPFSVKPLNR
PQEEQAVEASKFELGQDDKVGAPLTAVDEVLGDLPGGYGESRITLMPRDPQWAYAYWDIP
KEHKDALRSQGGQQLALRLYDVTDLDWQTASPHSVQEYLCDELAREWYLPIPVSDRDYAL
DIGYRTFDGRWLTLARSTPIRIPPVYPSDWVEEVFVTVNWDEDLQGKTIYQLVPPSKRPV
GVSTAVYDQVFDMAQGAEAMRMAGSLYGSMQHVPGSITHEQTLSSYVFPSGVGLWAAPNV
SGLNMSGIGMGYGLSSREFMASEAPVRPRQFWLVADAELIVYGATEPDATVTIGGRPIKL
NEDGTFRFQMSFQDGLIDYPIVAVAVDGEQTRNVHMKFTRETPSRNTNTKEEAVPEWFS
Download sequence
Identical sequences Q55770
gi|383326530|ref|YP_005387384.1| 1148.sll0185 gi|16331619|ref|NP_442347.1| gi|16331619|ref|NP_442347.1| gi|383492414|ref|YP_005410091.1| WP_010873644.1.11876 WP_010873644.1.1889 WP_010873644.1.18904 WP_010873644.1.33690 WP_010873644.1.35395 WP_010873644.1.47586 WP_010873644.1.99424 gi|383323361|ref|YP_005384215.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]