SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q55808 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q55808
Domain Number 1 Region: 3-341,494-522
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.13e-41
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q55808
Sequence length 542
Comment (tr|Q55808|Q55808_SYNY3) B-carotene ketolase {ECO:0000313|EMBL:BAA10561.1} KW=Complete proteome; Reference proteome OX=1111708 OS=Synechocystis sp. (strain PCC 6803 / Kazusa). GN=crtO OC=Synechocystis.
Sequence
MITTDVVIIGAGHNGLVCAAYLLQRGLGVTLLEKREVPGGAATTEALMPELSPQFRFNRC
AIDHEFIFLGPVLQELNLAQYGLEYLFCDPSVFCPGLDGQAFMSYRSLEKTCAHIATYSP
RDAEKYRQFVNYWTDLLNAVQPAFNAPPQALLDLALNYGWENLKSVLAIAGSKTKALDFI
RTMIGSPEDVLNEWFDSERVKAPLARLCSEIGAPPSQKGSSSGMMMVAMRHLEGIARPKG
GTGALTEALVKLVQAQGGKILTDQTVKRVLVENNQAIGVEVANGEQYRAKKGVISNIDAR
RLFLQLVEPGALAKVNQNLGERLERRTVNNNEAILKIDCALSGLPHFTAMAGPEDLTGTI
LIADSVRHVEEAHALIALGQIPDANPSLYLDIPTVLDPTMAPPGQHTLWIEFFAPYRIAG
LEGTGLMGTGWTDELKEKVADRVIDKLTDYAPNLKSLIIGRRVESPAELAQRLGSYNGNV
YHLDMSLDQMMFLRPLPEIANYQTPIKNLYLTGAGTHPGGSISGMPGRNCARVFLKQQRR
FW
Download sequence
Identical sequences L8AME0 Q55808
gi|16331763|ref|NP_442491.1| WP_010873789.1.11876 WP_010873789.1.1889 WP_010873789.1.18904 WP_010873789.1.33690 WP_010873789.1.35395 WP_010873789.1.47586 WP_010873789.1.99424 gi|383323506|ref|YP_005384360.1| gi|16331763|ref|NP_442491.1| gi|383492559|ref|YP_005410236.1| gi|383326675|ref|YP_005387529.1| 1148.slr0088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]