SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q55984 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q55984
Domain Number 1 Region: 62-232,326-433
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.31e-18
Family FAD/NAD-linked reductases, N-terminal and central domains 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q55984
Sequence length 522
Comment (tr|Q55984|Q55984_SYNY3) Sll0659 protein {ECO:0000313|EMBL:BAA10765.1} KW=Complete proteome; Reference proteome OX=1111708 OS=Synechocystis sp. (strain PCC 6803 / Kazusa). GN=sll0659 OC=Synechocystis.
Sequence
MNYATTPTAFVESKLNSMPGDALGYLRRLDQRWQALCQGDLPPIAEVAQKVNTNLGEADF
DAVICGGTLGILLAASLQIRGWQVVVIERGKLQGRAQEWNISRQELQTFVELELLTSEEL
ETAIASEYNPGRIAFHGGQEFWIKNVLNVGIDPIYLLEKLKQKFLQAGGKLLEHSAFQKA
IIHSDGVAISYQHDGENQVERKLTSRLLIDAMGHGSPLVNQARQGEIPDGVCLVVGSCAQ
GYSDNETGDLIATTTGITNHCQYFWEAFPARDGRTTYLFTYVDVHPERISLEFFFQEYFR
LLPEYQKINLDQLQWQRFLSGFFPAYKSSPLHFSWGRVLAVGDSAGSQSPVSFGGFGAMV
RHLKRLTNAIGEALAGDYLAAEDLALLQPYQPNIGVTWLFQQTMGVKVGQTADPEQINRL
MNAVFAVMDRQGQEVMEPFLQDVIQWSGLTQTLPRVNPLIVLPLLPQIGLPALMEWLGHY
ANLAGYSLTYPLAKNLLFTNPSFEQKRRLEAWYYGSGYDFHH
Download sequence
Identical sequences L8ANT3 Q55984
1148.sll0659 SgR65 gi|383326878|ref|YP_005387732.1| gi|16331966|ref|NP_442694.1| gi|383323709|ref|YP_005384563.1| gi|383492762|ref|YP_005410439.1| WP_010873989.1.11876 WP_010873989.1.1889 WP_010873989.1.18904 WP_010873989.1.33690 WP_010873989.1.35395 WP_010873989.1.47586 WP_010873989.1.99424 gi|16331966|ref|NP_442694.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]