SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q566K9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q566K9
Domain Number 1 Region: 8-282
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.94e-91
Family Eukaryotic proteases 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q566K9
Sequence length 362
Comment (tr|Q566K9|Q566K9_XENTR) Uncharacterized protein {ECO:0000313|EMBL:AAH93474.1} OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=LOC595077 OC=Silurana.
Sequence
MLRFLSLMLIFLLQRGSVGAASLPSTNDVSVCGVPIVSDRIVGGTNSMKGEWPWQISLSY
KGQTVCGGSLITDSWVLTAAHCFDSQKVSQYIVYLGVYQLSNLKNPNTVSSGVKRIIINK
AYQYEGSSGDIALIELEKPVTFTPYILPVCLPPPASELPAGTKCWVTGWGDIKEGQDLSN
PKTLQKASVKLIDWNSCEPMYETTFGYKPSVPFIMDDMFCAGYKEGQIDACQGDSGGPLV
CNVNNTWWQYGIISWGIGCAEANAPGVYTKVQYYDSWIKQYIPSIKISEAGSSTVVDTIR
LLEQSLNSSIGFLDTNGLNSTTNNSGASFELIKTLDSGAHNQKWSHLTIALGLVYLCLGH
LW
Download sequence
Identical sequences Q566K9
NP_001025685.1.99540 gi|62201369|gb|AAH93474| gi|71895773|ref|NP_001025685|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]