SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q57954 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q57954
Domain Number 1 Region: 244-388
Classification Level Classification E-value
Superfamily Flavoproteins 1.68e-34
Family Flavodoxin-related 0.00058
Further Details:      
 
Domain Number 2 Region: 28-280
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 3.76e-31
Family ROO N-terminal domain-like 0.0000422
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q57954
Sequence length 391
Comment (sp|Q57954|Y534_METJA) Uncharacterized protein MJ0534 KW=Complete proteome; Reference proteome OX=243232 OS=JCM 10045 / NBRC 100440) (Methanococcus jannaschii). GN=MJ0534; OC=Methanocaldococcaceae; Methanocaldococcus.
Sequence
MVKYMVLKIKDNIYCMSFIEWKIKEYRGLDIEKGTTYNSYLILDKNNVIIDTTRIKYFDE
LLSYLKDVANLKLDYIISNHISPDHNECIEKLIELTEAKIVTTKIRKYYLDAQFNTKDWE
FVIVKNGDELNIGNRTLKFITDDKCEYMLTYCVEDKILFSNDLFSQHVVYKEKIDSDIGH
KIMLDAKEYFANILLPYRKSILKILNILKDLDLEYICPSHGVIWHIMIDEILTKYRMWCS
DSYKNTAVIVYATIYSSTEKIAKALGEGLSEEGVDVIYHRLDTSPLNIIMRDILDAKYVL
VGSPTINMNVHPKVGMLLTYIEGLKPSNKKIGVAFGSYGWKECATKKIIEAFKRLGFKIV
DDKILTFRFAPKENDIKKIKEFGRKLAKINV
Download sequence
Identical sequences Q57954
gi|15668714|ref|NP_247513.1| WP_010870038.1.84152 243232.MJ0534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]