SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q58013 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q58013
Domain Number - Region: 51-121
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.0129
Family Restriction endonuclease MspI 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q58013
Sequence length 141
Comment (sp|Q58013|Y596_METJA) Uncharacterized protein MJ0596 KW=Complete proteome; Reference proteome OX=243232 OS=JCM 10045 / NBRC 100440) (Methanococcus jannaschii). GN=MJ0596; OC=Methanocaldococcaceae; Methanocaldococcus.
Sequence
MEDKIEFMAKHKKWFVVKKLKIDENTEDIEIARLLASIDETVLNKIPEYLPFDMNKLYEI
ADGIYQKKKGRITEEEIAEVLKKLKSPATTRKLNEITESKEGKEILKAILNNIILERLGI
QTRVSPKVIEKYIENSQSSNR
Download sequence
Identical sequences Q58013
WP_010870100.1.84152 gi|15668776|ref|NP_247578.1| 243232.MJ0596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]