SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q58895 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q58895
Domain Number - Region: 3-113
Classification Level Classification E-value
Superfamily beta and beta-prime subunits of DNA dependent RNA-polymerase 0.0339
Family RNA-polymerase beta 0.069
Further Details:      
 
Domain Number - Region: 87-147
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.0349
Family Hjc-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q58895
Sequence length 230
Comment (sp|Q58895|T2M5_METJA) Type II restriction enzyme MjaV KW=Complete proteome; Reference proteome OX=243232 OS=JCM 10045 / NBRC 100440) (Methanococcus jannaschii). GN=mjaVR; OC=Methanocaldococcaceae; Methanocaldococcus.
Sequence
MDDKSYYEEIESILRQILQPIEKISFSTFIRVVSGYKIIPIDLSKKEDKELINDLAKACN
EVIEEIKKTGGVKTKEGKTPKRVNEVGNHIEHYVKDVLNKYGYAITPKTKKGKQKSTGYP
DIEFWYKGKKERDGRVVYIEIKTFNEKNINSSHRTFYASPSKDEEGVKIRYDAPHLCLSF
KIEKLGRDYYATGFKIIDLSKLKGGIKREFNASNRELYKKDLIIYEKDLK
Download sequence
Identical sequences Q58895
gi|15669694|ref|NP_248507.1| 243232.MJ1500 WP_010871023.1.84152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]