SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q58E16 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q58E16
Domain Number 1 Region: 1-140
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.26e-44
Family Glutathione peroxidase-like 0.00000305
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q58E16
Sequence length 143
Comment (tr|Q58E16|Q58E16_XENLA) Glutathione peroxidase {ECO:0000256|RuleBase:RU000499} KW=Complete proteome; Reference proteome OX=8355 OS=Xenopus laevis (African clawed frog). GN=XELAEV_18023802mg OC=Xenopus.
Sequence
MSRLQDMYGSRGLQVLAFPCNQFGHQENSGNQEILNILQHVRPGGDFKPNFPLFEKVDVN
GEKEHPLFTFLKQQLPYPSDDSLSLMQDPKSIIWSPVRRNDIAWNFEKFLITKNGVPYKR
YGRRFETFNIQQDIEKLLDEKCA
Download sequence
Identical sequences Q58E16
NP_001089335.1.7800 gi|148222926|ref|NP_001089335| gi|62026275|gb|AAH92112|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]