SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q58E92 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q58E92
Domain Number 1 Region: 1-96
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.15e-18
Family SH3BGR (SH3-binding, glutamic acid-rich protein-like) 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q58E92
Sequence length 117
Comment (tr|Q58E92|Q58E92_XENLA) SH3 domain-binding glutamic acid-rich-like protein {ECO:0000256|PIRNR:PIRNR008142} KW=Complete proteome; Reference proteome OX=8355 OS=Xenopus laevis (African clawed frog). GN=XELAEV_18038929mg OC=Xenopus.
Sequence
MVIKVYIATSSGSTSIKKKQQDVLGFLHAVKIEYEEKDIAANEENRKWMRENVPENCRPT
NGNPLPPQIFNECKYCGDYDAFFEARENNVVYAFLGLTAPPGSKEAEALAKQNAESS
Download sequence
Identical sequences Q58E92
NP_001089999.1.7800 gi|148229363|ref|NP_001089999| gi|61401979|gb|AAH92023|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]