SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5B8S7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5B8S7
Domain Number 1 Region: 22-245
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.01e-56
Family Glycosyl hydrolases family 16 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q5B8S7
Sequence length 364
Comment (tr|Q5B8S7|Q5B8S7_EMENI) Putative transglycosidase, GH16 family (Eurofung) {ECO:0000313|EMBL:CBF83495.1} KW=Complete proteome; Reference proteome OX=227321 OS=194 / M139) (Aspergillus nidulans). GN=ANIA_03053 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MTLFRNLALLAASIAPVVAQTWTHCNPTKEDCEPNPALGTNYTWGFNETLNDKIWNVTNG
EINYTDDGAEFTIAKKLESPTIQSTFYIFFGILEFQAKMAKGGGIVSSVVLQSDDLDEID
WEWVGYNTTEIQTNYYSKGVTDYKNGKFYYVENADTEWHNYTTYWTSEKLEWWVDGQLLR
TLTYDEAKNGTESTFPQTPCNVRIGIWPAGDPNNAQGTIEWAGGEVDYDKGPYTMTVKDV
RVHDFNTGKAYEYGDSSGSWESINIIKGNSTAAEEINKPPPKSLSEKWDDLPSGAKAGVY
VGAAAAGAILLALFIFFFIRQRKKGRLEHALDDAKFNNERNEMNNYQSNWKQSEWRNGGY
QPVR
Download sequence
Identical sequences A0A1U8QWQ2 Q5B8S7
162425.CADANIAP00010026 XP_660657.1.1458 ANID_03053T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]