SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5BJ10 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5BJ10
Domain Number 1 Region: 232-288
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000122
Family PHD domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q5BJ10
Sequence length 296
Comment (sp|Q5BJ10|PF23A_DANRE) PHD finger protein 23A {ECO:0000305} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=phf23a OC=Cyprinidae; Danio.
Sequence
MLGIMDHHQDTVRKCKSEALPPERRKRTVEDFNKFCSFVLTYAGYIPPQKEESSWSPSSS
PCTHDLSELSGEGSVKDSWTDSHSDLNNIHNLVYKAETDSSSSREFSHLPSDNSLDKMTL
KDSLNHVHSKAERKKVKKLDRLSLGGPRKSISEARAHKQSKAALKKIKTSIKAERHFTSS
SPLNEGFEKEELTEQAIHMHEAGLKLESNQETDLSSCETDTLVTDEDIMVESGDDSWDLI
TCYCGKPFAGRPMIECEECSIWVHLSCAKIKKSNVPDIFYCYRCLDSRGSTVKRDH
Download sequence
Identical sequences A8E514 Q5BJ10
NP_001013517.1.45394 ENSDARP00000042480 7955.ENSDARP00000042480 ENSDARP00000042480 ENSDARP00000105631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]