SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5C277 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5C277
Domain Number 1 Region: 2-261
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.41e-59
Family Ankyrin repeat 0.00014
Further Details:      
 
Domain Number 2 Region: 234-314,349-394
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000615
Family Ankyrin repeat 0.0077
Further Details:      
 
Domain Number 3 Region: 466-508
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000667
Family SOCS box-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q5C277
Sequence length 541
Comment (tr|Q5C277|Q5C277_SCHJA) SJCHGC09185 protein {ECO:0000313|EMBL:AAX26248.2} OX=6182 OS=Schistosoma japonicum (Blood fluke). GN= OC=Schistosomatoidea; Schistosomatidae; Schistosoma.
Sequence
FYDALINNNIVELKRLIELHKIDLNARLSHVRKRNHTDLCPVHLVAYKGNLAMLHYLIQN
GVNVHQPTCTLRRPVHYAALRQQVSCLQMLLNAGAQIDARDTFGNTPLHYAAEDGDGGLL
SLLLNNGACVDAQDITNKTPLMKAARSGKVWAVRRLLLFGANVNVKDRNDETALHFACRQ
GSTEITRMLIKAESRLNAQNQIGLTPLMESVSYNQREAVSLLIKQKDIDLYKRDFSTGDT
ALHIAVKKNYIHIVEILLRAGNWYIEYNYNNLGESFVHDVIAYNRMELLRLFLAYNYDLD
RSAKRYPPNIQLLSSSSSSSSSAAAVAVATSSTCQSLLKSTQNTITTSTSMLSNTSSETN
SRINMNPSEKSPSQMALKRAHLDMARILPEVGCPRTRLHINSPNITTTTTNNNYYNSTTS
VCPTPSSSSSSSSTNNIETNTSNSMLRTTHILNQNLLTRRYNGLLEVKSLQKWCRKVIRQ
HLGFRFIETLPLLPIPVSLKDFLLLRDIDWSIYLHNRNSINQHHHHHYHHDSGELAIIVP
P
Download sequence
Identical sequences Q5C277
6182.Q5C277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]