SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5D078 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5D078
Domain Number 1 Region: 52-179
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.01e-46
Family Regulator of G-protein signaling, RGS 0.000000232
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q5D078
Sequence length 205
Comment (tr|Q5D078|Q5D078_MOUSE) Rgs4 protein {ECO:0000313|EMBL:AAH55293.1} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Rgs4 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHSSSHSKKDKVVTCQRVSQEEVKKWA
ESLENLIHHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFIS
VQATKEVNLDSCTREETSRNMLQPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLTNP
SSCGAEKQKGAKSSADCTSLVSQCA
Download sequence
Identical sequences Q5D078
10090.ENSMUSP00000027991 ENSMUSP00000027991 NP_033088.2.92730 ENSMUSP00000027991 ENSMUSP00000027991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]