SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5E9X4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5E9X4
Domain Number 1 Region: 19-124
Classification Level Classification E-value
Superfamily L domain-like 1.25e-26
Family Ngr ectodomain-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q5E9X4
Sequence length 306
Comment (sp|Q5E9X4|LRC59_BOVIN) Leucine-rich repeat-containing protein 59, N-terminally processed KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=LRRC59; OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MTKAGSKGGNLRDKLDGNELDLSLSDLNEVPVKELAALPKATVLDLSCNKLTTLPSDFCG
LTHLVKLDLSKNKLRQLPADFGRLVNLQHLDLLNNRLVTLPVSFAQLKSLKWLDLKDNPL
DPVLAKVAGDCLDEKQCKQCANKVLQHMKAVQADQERERQRRLEIDREAEKKWEAKQRAK
EAQERELRKREKAEEKERRRKEYDALKAAKREQEKKPKKETNQAPKSKSSSRPRKPPPRK
HTRSWAVLKLLLLLLLCVAGGLVACRVTELQQQPLCTSVNTIYDNAVRGLRSHDILQWVL
QTDSQQ
Download sequence
Identical sequences Q5E9X4
NP_001029750.1.59421 NP_001029750.1.76553 XP_006041216.1.26621 XP_010841091.1.44457 XP_019836610.1.53367 9913.ENSBTAP00000007978 ENSBTAP00000007978 ENSBTAP00000007978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]