SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5EBH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5EBH1
Domain Number 1 Region: 117-166
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000135
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.01
Further Details:      
 
Domain Number 2 Region: 283-357
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000114
Family Ras-binding domain, RBD 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q5EBH1
Sequence length 413
Comment (sp|Q5EBH1|RASF5_MOUSE) Regulator for cell adhesion and polarization enriched in lymphoid tissues KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Rassf5; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MASPAIGQRPYPLLLDPEPPRYLQSLGGTEPPPPARPRRCIPTALIPAAGASEDRGGRRS
GRRDPEPTPRDCRHARPVRPGLQPRLRLRPGSHRPRDVRSIFEQPQDPRVLAERGEGHRF
VELALRGGPGWCDLCGREVLRQALRCANCKFTCHSECRSLIQLDCRQKGGPALDRRSPES
TLTPTLNQNVCKAVEETQHPPTIQEIKQKIDSYNSREKHCLGMKLSEDGTYTGFIKVHLK
LRRPVTVPAGIRPQSIYDAIKEVNPAATTDKRTSFYLPLDAIKQLHISSTTTVSEVIQGL
LKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADYPLYLRLLAGPDTDVLSFVLKENETG
EVEWDAFSIPELQNFLTILEKEEQDKIHQLQKKYNKFRQKLEEALRESQGKPG
Download sequence
Identical sequences Q5EBH1
NP_061220.2.92730 10090.ENSMUSP00000027688 ENSMUSP00000027688 ENSMUSP00000027688 ENSMUSP00000027688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]