SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5FVP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5FVP7
Domain Number 1 Region: 44-134
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.65e-38
Family SCAN domain 0.0000487
Further Details:      
 
Domain Number 2 Region: 350-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.99e-26
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 394-454
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.62e-20
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 4 Region: 312-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.28e-18
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 480-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-17
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 6 Region: 210-255
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000209
Family KRAB domain (Kruppel-associated box) 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q5FVP7
Sequence length 554
Comment (tr|Q5FVP7|Q5FVP7_RAT) Zinc finger with KRAB and SCAN domains 3 {ECO:0000313|EMBL:AAH89847.1, ECO:0000313|Ensembl:ENSRNOP00000072953} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Zkscan3 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MARESRESTTLDSHSAEDQMELLVIKVEQEEVSPLAEETSWLGSPGPDRSRQRFRAFRYP
DAAGPRQALSRLRELCRQWLRPDMHSKEQILELLVLEQFLTILPGELQAWVREQHPDSGE
EVVALLEYLDRQLDETPPQVPDDDDGQELLCSKAVLLTSAQGSESSQMESMEPLLKQESL
GSLPSEVRVVTQAGHCGEDGVTATRLTSELQGLLKMEDVAPGLSPRWTEQDSSQMNLYKD
EMQENSGSLVSLDENMQTKVRDLPPAEENTEQKPEQTVCFLGEDTVQIPTGTEASEQEGK
LQTTQKNATGNRRFYCRECGKSFAQSSGLSKHKRIHTGLKPYECEECGKAFIGSSALIIH
QRVHTGEKPYECEECGKAFSHSSDLIKHQRTHTGEKPYECDDCGKTFTQSCSLLEHHRIH
TGEKPYQCNMCPKAFRRSSHLLRHQRTHTGDKDFFVPEPYWESQSRVESHWENIETPVSY
QCNDCERSFSRITSLIEHQKVHTGEKPFECQTCGKGFTRPSYLIQHQRRHTGKKTSVTVT
PAVHSEVGVQLSLN
Download sequence
Identical sequences Q5FVP7
ENSRNOP00000059514 10116.ENSRNOP00000024783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]