SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5FVY5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5FVY5
Domain Number 1 Region: 72-260
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.51e-52
Family Astacin 0.00014
Further Details:      
 
Domain Number 2 Region: 429-599
Classification Level Classification E-value
Superfamily TRAF domain-like 8.18e-37
Family MATH domain 0.00078
Further Details:      
 
Domain Number 3 Region: 269-430
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.38e-30
Family MAM domain 0.0024
Further Details:      
 
Domain Number 4 Region: 632-675
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000949
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q5FVY5
Sequence length 704
Comment (tr|Q5FVY5|Q5FVY5_XENTR) Endopeptidase-2 {ECO:0000256|PIRNR:PIRNR001196} OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=mep1a OC=Silurana.
Sequence
MGRQGLFRLCCLLGLSVCLTAISINHRPKQGNEADAGELREDIPQINLESGLNLFEGDIV
LPPRARNALLDDYYRWSFPIPYILADNLDLNAKSVILKAFEMFRLKSCVDFKPYEGEPTY
IHFQKFGGCWSMVGDLKVGQNLSIGERCDYKAIVEHEILHALGFYHEQSRSDRDDYVKIW
WEEITSGMEHNFNKYEDNYITDLNTPYDYESVMHYGPLSFNKNPDVPTITAKIEAFNDII
GQRLDFSEIDLERLNRMYNCTASHTLLDQCTFEYINICGMVQGTNDNADWVHEMSQPGSE
DHTLAGGCRDAGYFMHFDTHSGPIGSTALLESRILYPKRSEQCLQFFYKMDGSSQDRLVI
WLKTDDGAGNVRKMRKLHTIYGDSDRSWKIAHVTLNANKKFRYVFQGIHGNNKTSGGISL
DDISLTETPCPNTVWRVKDFSKILESTTKGDRIMSNPFYSPEGYAYGITIYPHGQASSPY
VNYTGISFHMISGEDDDVMEWPALNRQAIITVLDQDPNVQHRMSSSRSFTTLSSQIIESM
NNISRWERPSLIGTFDPTCDCYRTPDFGWSTFISHSQLHRRNFLKNDDLILFLEFEDLTF
LSKTEVPIRPAAPREKEVVLERSRRSPQNVDENPCDPNPCLNGGACVIEKGKASCRCASS
QAFSYAGEQCQSMQMHGNVLGMLIGGGAGVIALTMAILAIISRR
Download sequence
Identical sequences Q5FVY5
NP_001015767.1.99540 gi|58476372|gb|AAH89706| gi|62751743|ref|NP_001015767|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]