SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5HYF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5HYF3
Domain Number 1 Region: 65-280
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.33e-53
Family Ankyrin repeat 0.00012
Further Details:      
 
Domain Number 2 Region: 287-328
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000157
Family SOCS box-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q5HYF3
Sequence length 329
Comment (tr|Q5HYF3|Q5HYF3_HUMAN) cDNA FLJ39122 fis, clone NTONG2006783, weakly similar to ANKYRIN 1 {ECO:0000313|EMBL:BAC04791.1} OX=9606 OS=Homo sapiens (Human). GN=hCG_40522 OC=Catarrhini; Hominidae; Homo.
Sequence
MSVLEENRPFAQQLSNVYFTILSLFCFKLFVKISLAILSHFYIVKGNRKEAARIAAEFYG
VTQGQGSWADRSPLHEAASQGRLLALRTLLSQGYNVNAVTLDHVTPLHEACLGDHVACAR
TLLEAGANVNAITIDGVTPLFNACSQGSPSCAELLLEYGAKAQLESCLPSPTHEAASKGH
HECLDILISWGIDVDQEIPHLGTPLYVACMSQQFHCIWKLLYAGADVQKGKYWDTPLHAA
AQQSSTEIVNLLLEFGADINAKNTELLRPIDVATSSSMVERILLQHEATPSSLYQLCRLC
IRSYIGKPRLHLIPQLQLPTLLKNFLQYR
Download sequence
Identical sequences H2QQG5 Q5HYF3 Q8WWX0
ENSP00000296525 NP_543150.1.87134 NP_543150.1.92137 XP_003823484.1.60992 XP_005262816.1.92137 XP_009446875.1.37143 gi|18254476|ref|NP_543150.1| ENSP00000296525 9598.ENSPTRP00000028506 9606.ENSP00000296525 ENSPTRP00000028506 ENSP00000296525 ENSPTRP00000028506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]