SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5HZ70 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5HZ70
Domain Number 1 Region: 113-268
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.02e-46
Family Hypothetical protein AT3g04780/F7O18 27 0.0000652
Further Details:      
 
Domain Number 2 Region: 9-109
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.95e-21
Family Thioltransferase 0.0000135
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q5HZ70
Sequence length 289
Comment (tr|Q5HZ70|Q5HZ70_XENLA) MGC85151 protein {ECO:0000313|EMBL:AAH89153.1} OX=8355 OS=Xenopus laevis (African clawed frog). GN=MGC85151 OC=Xenopus.
Sequence
MVGVKVIGADGEFQGELTSAGSRLSVVKFTMKGCAPCVRISPAFTSLSNKYPHAIFLEVD
VHQCQSTATANNISATPTFLFFRNRVKIDLYQGADAAGLEDKIKQHLENDPGNNEDADIP
RGYMDLLPFVNKAGCECLNESDDHGFDNCLRKDPTYLESDCDEQLLMTVAFNQPVKLYSM
KLQGPDNGQGPKYVKIFINLPRSMDFDEAMRSEPTQAVELSADDIKEDSIVPLRYVKFQN
VNSVTLFVQSNQGDEEATRIAYLTFIGTPVQATNMNDFKRVVGKKGESH
Download sequence
Identical sequences Q5HZ70
gi|147899920|ref|NP_001089222| gi|57920948|gb|AAH89153| NP_001089222.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]