SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5HZU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5HZU5
Domain Number 1 Region: 11-265
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.54e-78
Family Eukaryotic proteases 0.000000231
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q5HZU5
Sequence length 265
Comment (tr|Q5HZU5|Q5HZU5_XENTR) Hypothetical LOC496993 {ECO:0000313|EMBL:AAH88882.1} OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=LOC496993 OC=Silurana.
Sequence
MLRLLVLAAFVLCGQCSNDIRLIEDHERVIGGTEVQRNSWPWQVSLQYLSGGSWYHTCGG
SLIRANRVLTAAHCVDRAVSYRVVVGDHNIYQNDGTEQYISVSRIVKHANWNPNNIAAGY
DISILHLSSSATLNSYVKLAQLPADNVVLAHNYNCVVTGWGKTSNNGNLASVLQQAPLPV
IAHSTCSSGSYWGSTVKSTMVCAGGDGVRSGCQGDSGGPLNCPVNGVYQVHGVTSFVSSS
GCSTYLKPTVFTRVSAYIGWINNNI
Download sequence
Identical sequences Q5HZU5
gi|57032843|gb|AAH88882| gi|58332834|ref|NP_001011493| NP_001011493.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]