SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5JIE9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5JIE9
Domain Number 1 Region: 5-253
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.26e-49
Family Biotin biosynthesis protein BioH 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q5JIE9
Sequence length 260
Comment (tr|Q5JIE9|Q5JIE9_THEKO) Lysophospholipase, alpha/beta hydrolase superfamily {ECO:0000313|EMBL:BAD85188.1} KW=Complete proteome; Reference proteome OX=69014 OS=(Pyrococcus kodakaraensis (strain KOD1)). GN=TK0999 OC=Thermococcus.
Sequence
MEIYKAKFGNPERGWVVLVHGLGEHSGRYGKLISMLNEAGFAVYTFDWPGHGKSPGKRGH
TSVEEAMEIIDSIIKELGEKPFLFGHSLGGLTVIRYAETRPDKIRGVVASSPALAKSPKT
PGFMVALAKVLGRIAPGLTLSNGIDPNLLSRNPDAVKRYIEDPLVHDRISTKLGMSIFKN
MELAHREADRIEVPILLLVGTGDVITPPEGSRKLFEELKVKDKEIREFEGAYHEIFEDPE
WGEEFHKTIVEWLIKHSEKA
Download sequence
Identical sequences Q5JIE9
gi|57640934|ref|YP_183412.1| 69014.TK0999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]