SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5JRJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5JRJ0
Domain Number 1 Region: 34-108
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 6.15e-30
Family Delta-sleep-inducing peptide immunoreactive peptide 0.0000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q5JRJ0
Sequence length 110
Comment (tr|Q5JRJ0|Q5JRJ0_HUMAN) TSC22 domain family protein 3 {ECO:0000313|Ensembl:ENSP00000361457} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=TSC22D3 OC=Catarrhini; Hominidae; Homo.
Sequence
MAFQPPYSSSLFRKRDNASGASVVAIDNKIEQAMDLVKNHLMYAVREEVEILKEQIRELV
EKNSQLERENTLLKTLASPEQLEKFQSCLSPEEPAPESPQVPEAPGGSAV
Download sequence
Identical sequences A0A2I2ZX64 A0A2I3TFG2 A0A2J8VAS1 Q5JRJ0
ENSGGOP00000023574 ENSP00000361457 ENSP00000361457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]