SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5KPZ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5KPZ4
Domain Number 1 Region: 110-263,368-398
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-20
Family SPRY domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q5KPZ4
Sequence length 618
Comment (tr|Q5KPZ4|Q5KPZ4_CRYNJ) Transcription regulator, putative {ECO:0000313|EMBL:AAW40716.1} KW=Complete proteome; Reference proteome OX=214684 OS=ATCC MYA-565) (Filobasidiella neoformans). GN=CNA01030 OC=Cryptococcus neoformans species complex.
Sequence
MSLENRLSPPLSRSETPALGTVGTVLDNATASLPLPNQNFPGEGLAGPGPSTTENHTKKV
IREDVERRQYARMGTIMPGTGDGLGIGEECFSWTDIPNVKNFRYHPCALSPTPSPHPVFP
FYRTIPYPPPIPPVHLSLLDRSSYLRISPSLLTIYNDRGFRSCRTNVSVREGTWYYEVHI
DRGDGEQGARRGAGGEGGNPHVRLGWGRREANLDTPVGCDAYSYAIRDVGGEKVHISRPK
PYANKGFRTGDIVGCLISLPRRPSLEDKPVSDPARIKRQRRAFNYKSQAYFESAEYTPSK
EMDALIDRDGKLAAAAKVESQAQEINGGDMPKKQMGATTKNTKKGKKQPEKAHEPVARKL
EKLSSSSISFFINGESFGEAFTDLYDFTPLPSLYPPVGGHGKKHHPGDEVLHDDGTLGYY
PMVSCFGRAKATCNFGPDFAHPLPEGARPMCERYAEFKEEERLLDEKDEVEDAERLRQIL
EAEKKMLSKVKPRNQKANSATASGENTPKRKKGPAPKRKREGRDGTEMSTPGVESVRGLT
ATPAPEAPMSEAGIEWREGTRERSMSVAASLGGQGWGTVKEEISDEREEKKIKKDKEVEV
KQENGGNSEDGEFEGINW
Download sequence
Identical sequences F5HCU1 Q5KPZ4
XP_566535.1.95466 XP_778097.1.65578 181.m08702 214684.CNA01030 sgtc|cn01104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]