SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5KQH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5KQH1
Domain Number 1 Region: 112-227
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000101
Family Pleckstrin-homology domain (PH domain) 0.031
Further Details:      
 
Weak hits

Sequence:  Q5KQH1
Domain Number - Region: 76-110
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0392
Family Mitotic arrest deficient-like 1, Mad1 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q5KQH1
Sequence length 250
Comment (tr|Q5KQH1|Q5KQH1_ORYSJ) Os05g0595500 protein {ECO:0000313|EMBL:BAF18430.1} KW=Complete proteome; Reference proteome OX=39947 OS=Oryza sativa subsp. japonica (Rice). GN=OsJ_19781 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MDDVYGRIEVFPQHFLPSQQSMETPADGLSTSKTNLDSPPSSRRRSWTPKRVMGAASLLH
LLSLPRIRWSSSTEDDDKIELTRAEVESLRTEIADAEERESQLKARLENIDEVLRYARLS
GYLYIRSRWTQLPGEPPILDDADVDDWLPRFVVLQGQCVYYYLKSTDLSPQESTLLCDIV
EVGQLPNFVPEDEKTRYAFYIMTSQGLKFECSSMSEIQVDSWVRAIRGDCGLSDGGESRS
KTSRQEVGSW
Download sequence
Identical sequences A2Y866 I1PYK4 Q5KQH1
39947.LOC_Os05g51710.1 ORGLA05G0245200.1 LOC_Os05g51710.1|13105.m05590|protein LOC_Os05g51710.1|PACid:21942620 XP_015639334.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]