SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5M7M6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5M7M6
Domain Number 1 Region: 103-133
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000402
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 2 Region: 42-90
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000458
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 
Weak hits

Sequence:  Q5M7M6
Domain Number - Region: 499-543
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000148
Family EGF-type module 0.045
Further Details:      
 
Domain Number - Region: 547-593
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000157
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number - Region: 166-236
Classification Level Classification E-value
Superfamily L-aspartase-like 0.0903
Family L-aspartase/fumarase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q5M7M6
Sequence length 595
Comment (tr|Q5M7M6|Q5M7M6_XENTR) C9-prov protein {ECO:0000313|EMBL:AAH88556.1} OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=c9-prov OC=Silurana.
Sequence
GRMDHIHLILAITTLCAFVSGEPSFSQTPKRLQREVNAPAPIDCQLSSWGSWSRCDPCTK
HRYRSRSIERFGQYGGAPCVNTLGDIQRCIPEEDCMEPPVFCGNDFECESGRCIKARLLC
NGDNDCGDYSDETCDDKDPKPPCRNMEIELSEIARTAGDGLNILGMKPKRNPFDNEYFNG
ICDRVRDGKTYFRKPWNVAALVYKTRADKSFTTETYHDAKSVMSKIIEGLTVNVDASLSL
KITPTEQKNLTVGASAGLGYSKNKSVQRLRQYSETKDKTYMRVSGTVQLASFQMRTRGAM
LSPTFIEDIKSLPRDYDKAEYFSILEMYGTHYTVSGTVGGKYDLVYVLDSIVMKSLDITT
EDVTDCLKLNAGANIGGTENGAKVDVNPNVKTDICNKGGGETETEPRRTQKPVIESIISF
VDGGSVEYVTALEEKLNKKEPVADVDDYIQWASSLKDSPTVINSKSNPIISLIPTDIKDA
YIKTRNLERAIEEYLDEHSVCKCQPCQNGGKVMVIDGECICKCTLHYEGVACQNIKSDLF
STPKQPIDGGWGCWTISSNCVDGEMIATRKCDNPVPQEGGKPCHGQQTKKIPCEK
Download sequence
Identical sequences Q5M7M6
gi|56789647|gb|AAH88556|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]