SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5M8V7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5M8V7
Domain Number 1 Region: 8-265
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.03e-81
Family Eukaryotic proteases 0.00000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q5M8V7
Sequence length 266
Comment (tr|Q5M8V7|Q5M8V7_XENTR) LOC496680 protein {ECO:0000313|EMBL:AAH87810.1} OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=LOC496680 OC=Silurana.
Sequence
LVLTAVLAALAHGCGVPTYHPNARVVNGDDARPYSWPWQVSLQVLNSGSRYGHYCGGSLI
APRWVVTAAHCIHYTNTYRIVLGEHDLILEEGAEQNIPINNSDIFNHPKWNRGCAECGYD
IALIKLSREAQLNDKVQLGCIPPTGETLSHNQLCYVTGWGRLTSTGPYPDILQQADLPVV
GISVCTRSDWWGEMNEKTLVCAGAAGKAACNGDSGGPLNCQSPDGRWFVHGVTSFGPGAC
NLPKRPSVFTRVSEYNDWVQEIMDKN
Download sequence
Identical sequences Q5M8V7
gi|56611135|gb|AAH87810|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]