SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5M8W5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5M8W5
Domain Number 1 Region: 23-132
Classification Level Classification E-value
Superfamily PH domain-like 2.28e-35
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000887
Further Details:      
 
Domain Number 2 Region: 230-339
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 6.28e-23
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000302
Further Details:      
 
Domain Number 3 Region: 398-458
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.000000000000654
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q5M8W5
Sequence length 470
Comment (tr|Q5M8W5|Q5M8W5_XENTR) Was-prov protein {ECO:0000313|EMBL:AAH87802.1} OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=was-prov OC=Silurana.
Sequence
KAAVRQQDNVSSSLLLPQENQKVFQLLGRKCTTLATTVVQLLVAQGGDRWAKQFLGVLCL
VKDNPRRSYYFQLFDLQEEKAVWEQELYEQLRYLPARPYFHTFCSDECQTGLNFADEAEA
ADFQVVVEEKLKKKQHRQDRRQNLPPPPPVSDDRRTSLPLPPPPGPGPFPNGPSSPQPLA
PSQSLNMPAVSIPNPDITSARYRALSAPADKGKNKKGKKKFSKADIGAPSGFKHVSHVGW
DPNSGFDVNQLDPDIRNLFSRAGISDAQLKDAETSKLIYDFIEQQGGVEAVKNEMRRGET
APPPPPPSRNAPPAPTPSRGRTGPLPPPPVRGSSAPPPPPPSRSTPPIPPPTARSGGPPP
PPPPPPSIPAPPPTSGPAPPPPPPVSGTQSIPSPTPSGGRGALLDQIRQGTKLNKLTVSA
EPPPSPQPSSEGLVGALMHVMQKRSKAIHSSDDDDDEDGADDDEDDEWDD
Download sequence
Identical sequences Q5M8W5
gi|56611160|gb|AAH87802|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]