SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5M8Y0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5M8Y0
Domain Number 1 Region: 219-461
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.6e-83
Family Eukaryotic proteases 0.00000723
Further Details:      
 
Domain Number 2 Region: 41-103
Classification Level Classification E-value
Superfamily GLA-domain 2.75e-25
Family GLA-domain 0.00018
Further Details:      
 
Domain Number 3 Region: 129-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000565
Family EGF-type module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q5M8Y0
Sequence length 463
Comment (tr|Q5M8Y0|Q5M8Y0_XENTR) Coagulation factor 9 {ECO:0000313|EMBL:AAH87787.1, ECO:0000313|Ensembl:ENSXETP00000007509} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=f9 OC=Silurana.
Sequence
MVAFSSILIIYLLTSLCSTEKAVFLSDESASSLLVRQKRYNTGRLEEWVAGNLERECLEE
KCNYEEAREVFENDDKTKEFWKQYIDGDQCLSNPCLNGGVCKDDVSDYVCWCQQGYSGKN
CELELPVICSIMNGGCDHMCRDDPVKKVICSCASGYKLAENGKTCEAAVPYPCGRVSSPE
ALPKEETRSFLDSLEQNLTSAAHPNITDQEKPKEDIVPVTVDPNVRIVGGTDSLKGEFPW
QVHLVNKDNLGFCSGSIINEKWIVTAAHCFLIRGEFKVVAGEHNTEVSDGTEQHHKVTRI
ILYPAYNATRSKYNNDIALLELEKPLELNDYVRPVCIGNMDFTEKLLKRNAFSMVSGWGD
LGYKGRPAVILQKLAVPYINQAACKKSSRFSIYANMFCAGYSDESKDTCQGDSGGPHVTE
YKNLWFLTGITSWGEKCAEKDKYGVYTRLSRFTDWIRTTTKIS
Download sequence
Identical sequences Q5M8Y0
ENSXETP00000007509 ENSXETP00000007509 gi|56611133|gb|AAH87787| gi|58332150|ref|NP_001011223| NP_001011223.1.99540 8364.ENSXETP00000007509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]