SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5N223 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5N223
Domain Number 1 Region: 2-75
Classification Level Classification E-value
Superfamily L28p-like 1.35e-26
Family Ribosomal protein L28 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q5N223
Sequence length 78
Comment (sp|Q5N223|RL28_SYNP6) 50S ribosomal protein L28 {ECO:0000255|HAMAP-Rule:MF_00373} KW=Complete proteome OX=269084 OS=(Anacystis nidulans). GN=syc1457_d; OC=Synechococcus.
Sequence
MSRVCQLTGKKANNAYAISHSHRRTKRLQNVNLQEKRIWWPEGNRFVKLRLSTKAIKTLQ
KKGLSAYARELGIDLKRL
Download sequence
Identical sequences Q31S95 Q5N223
gi|81298853|ref|YP_399061.1| 1140.Synpcc7942_0042 269084.syc1457_d WP_011243767.1.45845 WP_011243767.1.5740 WP_011243767.1.95485 gi|56751466|ref|YP_172167.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]