SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5N7G9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5N7G9
Domain Number 1 Region: 21-137
Classification Level Classification E-value
Superfamily PX domain 9.16e-34
Family PX domain 0.00039
Further Details:      
 
Domain Number 2 Region: 183-395
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000000101
Family BAR domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q5N7G9
Sequence length 399
Comment (tr|Q5N7G9|Q5N7G9_ORYSJ) cDNA clone:J033089O16, full insert sequence {ECO:0000313|EMBL:BAG95491.1} KW=Complete proteome; Reference proteome OX=39947 OS=Oryza sativa subsp. japonica (Rice). GN=OSNPB_010862300 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MSQERSQSQSPRSPASAAGVPFLSISVTDPVKMGTGVQAYISYRVITKTNLPDFEGQEKI
VIRRYSDFEWLHDRLAEKYKGIFIPPLPEKNAVEKFRFSKEFIELRRQALDLFVNRIASH
PELKQSGDLKIFLQADEEKMDRERSYETGIFKKPSDFLQMFKDVQSKVSDVVLGKEKPVE
ESSPEYEKLKNYIFELENHLAEAQKQAFRLVKRHRELGQSLADFGKAIKLLGACEGDSLE
KVFSEVGSKSEMLSVKLQREADNLLFNFEEPLKDYVRAVQSIKATMVDRANAFRQHHDLF
QQKEYKGVNLEKLKFVNPDKFSELEAEVRELTADSEEATKRFEHIVAVMNEELARFQEQK
TADIGFAFHEFAKGQAKLAKDIADAWRGVLPKLEACSTS
Download sequence
Identical sequences I1NTK9 Q5N7G9
LOC_Os01g64280.1|PACid:21909473 LOC_Os01g64280.1|13101.m06919|protein 39947.LOC_Os01g64280.1 ORGLA01G0319900.1 XP_015620548.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]